Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase V
LigandBDBM50237496
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1660853
Ki 354±n/a nM
Citation Carta FBirkmann APfaff TBuschmann HSchwab WZimmermann HMaresca ASupuran CT Lead Development of Thiazolylsulfonamides with Carbonic Anhydrase Inhibitory Action. J Med Chem 60:3154-3164 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase V
Name:Carbonic anhydrase V
Synonyms:CA-VA | Carbonate dehydratase VA | Carbonic anhydrase 5A (CA VA) | Carbonic anhydrase 5A, mitochondrial | Carbonic anhydrase 5A, mitochondrial precursor | Carbonic anhydrase VA (CA VA)
Type:Enzyme
Mol. Mass.:34755.54
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme
Residue:305
Sequence:
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPG
GTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPL
ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVI
GVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLT
ESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN
EGTRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50237496
n/a
NameBDBM50237496
Synonyms:CHEMBL4100256
TypeSmall organic molecule
Emp. Form.C21H24N4O5S2
Mol. Mass.476.569
SMILESCC([O-])=O.CN(C(=O)Cc1ccc(cc1)-c1cccc[n+]1C)c1nc(C)c(s1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: