Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase VB
LigandBDBM50237363
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1660854
Ki 24±n/a nM
Citation Carta FBirkmann APfaff TBuschmann HSchwab WZimmermann HMaresca ASupuran CT Lead Development of Thiazolylsulfonamides with Carbonic Anhydrase Inhibitory Action. J Med Chem 60:3154-3164 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase VB
Name:Carbonic Anhydrase VB
Synonyms:CA-VB | Carbonate dehydratase VB | Carbonic anhydrase 5B (CA VB) | Carbonic anhydrase 5B, mitochondrial | Carbonic anhydrase 5B, mitochondrial precursor | Carbonic anhydrase VB (CA VB)
Type:Enzyme
Mol. Mass.:36440.83
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme
Residue:317
Sequence:
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPG
GDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVI
GVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDY
VLNVQAKPKPATSQATP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50237363
n/a
NameBDBM50237363
Synonyms:CHEMBL4100366
TypeSmall organic molecule
Emp. Form.C19H20N4O3S2
Mol. Mass.416.517
SMILESCCc1nc(sc1S(N)(=O)=O)N(C)C(=O)Cc1ccc(cc1)-c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: