Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPyrimidinergic receptor P2Y4
LigandBDBM50237572
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1661636
IC50 1760±n/a nM
Citation Rafehi MMalik EMNeumann AAbdelrahman AHanck TNamasivayam VMüller CEBaqi Y Development of Potent and Selective Antagonists for the UTP-Activated P2Y J Med Chem 60:3020-3038 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pyrimidinergic receptor P2Y4
Name:Pyrimidinergic receptor P2Y4
Synonyms:P2P | P2Y purinoceptor 4 | P2Y4 | UNR | Uridine nucleotide receptor
Type:PROTEIN
Mol. Mass.:40977.17
Organism:Homo sapiens (Human)
Description:ChEMBL_751027
Residue:365
Sequence:
MASTESSLLRSLGLSPGPGSSEVELDCWFDEDFKFILLPVSYAVVFVLGLGLNAPTLWLF
IFRLRPWDATATYMFHLALSDTLYVLSLPTLIYYYAAHNHWPFGTEICKFVRFLFYWNLY
CSVLFLTCISVHRYLGICHPLRALRWGRPRLAGLLCLAVWLVVAGCLVPNLFFVTTSNKG
TTVLCHDTTRPEEFDHYVHFSSAVMGLLFGVPCLVTLVCYGLMARRLYQPLPGSAQSSSR
LRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLEADCRVLNIVNVVYKVTRPLASANSC
LDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTP
RADRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50237572
n/a
NameBDBM50237572
Synonyms:CHEMBL4065831
TypeSmall organic molecule
Emp. Form.C26H16BrN2NaO6S
Mol. Mass.587.374
SMILES[Na+].Nc1c2C(=O)c3ccccc3C(=O)c2c(Nc2ccc(Oc3ccc(Br)cc3)cc2)cc1S([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: