Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntestinal alkaline phosphatase
LigandBDBM50237965
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1662570
IC50 4060±n/a nM
Citation Salar UKhan KMIqbal JEjaz SAHameed AAl-Rashida MPerveen STahir MN Coumarin sulfonates: New alkaline phosphatase inhibitors; in vitro and in silico studies. Eur J Med Chem 131:29-47 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Intestinal alkaline phosphatase
Name:Intestinal alkaline phosphatase
Synonyms:Alkaline phosphatase, intestinal
Type:PROTEIN
Mol. Mass.:56804.94
Organism:Homo sapiens (Human)
Description:ChEMBL_1278525
Residue:528
Sequence:
MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLG
DGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLC
GVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADA
SQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRD
PTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERA
GQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF
NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV
MAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50237965
n/a
NameBDBM50237965
Synonyms:CHEMBL4068298
TypeSmall organic molecule
Emp. Form.C16H9Cl2NO7S
Mol. Mass.430.216
SMILESCc1c(Cl)c(=O)oc2cc(OS(=O)(=O)c3ccc(Cl)c(c3)[N+]([O-])=O)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: