Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 11B1
LigandBDBM50238115
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1662802
IC50 2±n/a nM
Citation Meguro MMiyauchi SKanao YNaito SSuzuki KInoue SYamada KHomma TChiba KNara FFuruzono S 4-Anilino-pyrimidine, novel aldosterone synthase (CYP11B2) inhibitors bearing pyrimidine structures. Bioorg Med Chem Lett 27:1902-1906 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 11B1
Name:Cytochrome P450 11B1
Synonyms:CYPXIB1 | Cytochrome P450 11B, mitochondrial precursor | Cytochrome P450 11B1 | Cytochrome P450 11B1 (CYP11B1)
Type:Enzyme
Mol. Mass.:57591.44
Organism:Homo sapiens (Human)
Description:P15538
Residue:503
Sequence:
MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQG
YEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELS
PDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQED
IKMVYSFILRPSMFPLLTFRAIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50238115
n/a
NameBDBM50238115
Synonyms:CHEMBL4082403
TypeSmall organic molecule
Emp. Form.C18H20F4N4O3S
Mol. Mass.448.435
SMILESCS(=O)(=O)N1CCC(CC1)C(O)(c1cncnc1Nc1ccc(F)cc1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: