Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMono [ADP-ribose] polymerase PARP16
LigandBDBM50238419
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1663209
IC50<5012±n/a nM
Citation Thomson DWWagner AJBantscheff MBenson REDittus LDuempelfeld BDrewes GKrause JMoore JTMueller KPoeckel DRau CSalzer EShewchuk LHopf CEmery JGMuelbaier M Discovery of a Highly Selective Tankyrase Inhibitor Displaying Growth Inhibition Effects against a Diverse Range of Tumor Derived Cell Lines. J Med Chem 60:5455-5471 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mono [ADP-ribose] polymerase PARP16
Name:Mono [ADP-ribose] polymerase PARP16
Synonyms:2.4.2.30 | ADP-ribosyltransferase diphtheria toxin-like 15 | C15orf30 | Mono [ADP-ribose] polymerase PARP16 | PARP-16 | PARP16 | Poly [ADP-ribose] polymerase 16 | Synonyms=ARTD15
Type:PROTEIN
Mol. Mass.:36398.93
Organism:Homo sapiens (Human)
Description:ChEMBL_117586
Residue:322
Sequence:
MQPSGWAAAREAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLA
DASKLPNLKELLQSSGDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVP
APDFLFEIEYFDPANAKFYETKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEG
TYLTSDLSLALIYSPHGHGWQHSLLGPILSCVAVCEVIDHPDVKCQTKKKDSKEIDRRRA
RIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKRASSQLSWFSSHWFTVMISLYLL
LLLIVSVINSSAFQHFWNRAKR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50238419
n/a
NameBDBM50238419
Synonyms:CHEMBL4060134
TypeSmall organic molecule
Emp. Form.C24H22N10O2
Mol. Mass.482.4973
SMILESCn1cnc(c1)C(=O)N1CCN(CC1)C(=O)c1ccc(Nc2nc3ccccc3n3nnnc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: