Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman diphtheria toxin-like ADP-ribosyltransferase (ARTD8 or PARP14)
LigandBDBM50238428
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1663208
IC50<5012±n/a nM
Citation Thomson DWWagner AJBantscheff MBenson REDittus LDuempelfeld BDrewes GKrause JMoore JTMueller KPoeckel DRau CSalzer EShewchuk LHopf CEmery JGMuelbaier M Discovery of a Highly Selective Tankyrase Inhibitor Displaying Growth Inhibition Effects against a Diverse Range of Tumor Derived Cell Lines. J Med Chem 60:5455-5471 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human diphtheria toxin-like ADP-ribosyltransferase (ARTD8 or PARP14)
Name:Human diphtheria toxin-like ADP-ribosyltransferase (ARTD8 or PARP14)
Synonyms:(ARTD8 or PARP14) | (ARTD8 or PARP14, Y1660L) | 2.4.2.30 | ADP-ribosyltransferase diphtheria toxin-like 8 | ARTD8 | B aggressive lymphoma protein 2 | BAL2 | BAL2 | Human diphtheria toxin-like ADP-ribosyltransferase (ARTD8 or PARP14, Y1660L) | KIAA1268 | PARP-14 | PARP14 | Poly [ADP-ribose] polymerase 14
Type:n/a
Mol. Mass.:202812.41
Organism:Homo sapiens (Human)
Description:Q460N5
Residue:1801
Sequence:
MAVPGSFPLLVEGSWGPDPPKNLNTKLQMYFQSPKRSGGGECEVRQDPRSPSRFLVFFYP
EDVRQKVLERKNHELVWQGKGTFKLTVQLPATPDEIDHVFEEELLTKESKTKEDVKEPDV
SEELDTKLPLDGGLDKMEDIPEECENISSLVAFENLKANVTDIMLILLVENISGLSNDDF
QVEIIRDFDVAVVTFQKHIDTIRFVDDCTKHHSIKQLQLSPRLLEVTNTIRVENLPPGAD
DYSLKLFFENPYNGGGRVANVEYFPEESSALIEFFDRKVLDTIMATKLDFNKMPLSVFPY
YASLGTALYGKEKPLIKLPAPFEESLDLPLWKFLQKKNHLIEEINDEMRRCHCELTWSQL
SGKVTIRPAATLVNEGRPRIKTWQADTSTTLSSIRSKYKVNPIKVDPTMWDTIKNDVKDD
RILIEFDTLKEMVILAGKSEDVQSIEVQVRELIESTTQKIKREEQSLKEKMIISPGRYFL
LCHSSLLDHLLTECPEIEICYDRVTQHLCLKGPSADVYKAKCEIQEKVYTMAQKNIQVSP
EIFQFLQQVNWKEFSKCLFIAQKILALYELEGTTVLLTSCSSEALLEAEKQMLSALNYKR
IEVENKEVLHGKKWKGLTHNLLKKQNSSPNTVIINELTSETTAEVIITGCVKEVNETYKL
LFNFVEQNMKIERLVEVKPSLVIDYLKTEKKLFWPKIKKVNVQVSFNPENKQKGILLTGS
KTEVLKAVDIVKQVWDSVCVKSVHTDKPGAKQFFQDKARFYQSEIKRLFGCYIELQENEV
MKEGGSPAGQKCFSRTVLAPGVVLIVQQGDLARLPVDVVVNASNEDLKHYGGLAAALSKA
AGPELQADCDQIVKREGRLLPGNATISKAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRA
VQLSLCLAEKYKYRSIAIPAISSGVFGFPLGRCVETIVSAIKENFQFKKDGHCLKEIYLV
DVSEKTVEAFAEAVKTVFKATLPDTAAPPGLPPAAAGPGKTSWEKGSLVSPGGLQMLLVK
EGVQNAKTDVVVNSVPLDLVLSRGPLSKSLLEKAGPELQEELDTVGQGVAVSMGTVLKTS
SWNLDCRYVLHVVAPEWRNGSTSSLKIMEDIIRECMEITESLSLKSIAFPAIGTGNLGFP
KNIFAELIISEVFKFSSKNQLKTLQEVHFLLHPSDHENIQAFSDEFARRANGNLVSDKIP
KAKDTQGFYGTVSSPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSK
AILECAGQNVERECSQQAQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEK
KNYSSICLPAIGTGNAKQHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFY
ANMKKREGTQLSSQQSVMSKLASFLGFSKQSPQKKNHLVLEKKTESATFRVCGENVTCVE
YAISWLQDLIEKEQCPYTSEDECIKDFDEKEYQELNELQKKLNINISLDHKRPLIKVLGI
SRDVMQARDEIEAMIKRVRLAKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDAR
REKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVV
ELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQL
FHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYY
VRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFR
K
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50238428
n/a
NameBDBM50238428
Synonyms:CHEMBL4087876
TypeSmall organic molecule
Emp. Form.C19H17N7O2
Mol. Mass.375.384
SMILESO=C(N1CCOCC1)c1ccc(Nc2nc3ccccc3n3nnnc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: