Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 8
LigandBDBM50380399
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1664931
IC50 1479±n/a nM
Citation Ballante FReddy DRZhou NJMarshall GR Structural insights of SmKDAC8 inhibitors: Targeting Schistosoma epigenetics through a combined structure-based 3D QSAR, in vitro and synthesis strategy. Bioorg Med Chem 25:2105-2132 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 8
Name:Histone deacetylase 8
Synonyms:HDAC8 | Histone deacetylase 8
Type:PROTEIN
Mol. Mass.:49771.73
Organism:Schistosoma mansoni
Description:ChEMBL_116785
Residue:440
Sequence:
MSVGIVYGDQYRQLCCSSPKFGDRYALVMDLINAYKLIPELSRVPPLQWDSPSRMYEAVT
AFHSTEYVDALKKLQMLHCEEKELTADDELLMDSFSLNYDCPGFPSVFDYSLAAVQGSLA
AASALICRHCEVVINWGGGWHHAKRSEASGFCYLNDIVLAIHRLVSSTPPETSPNRQTRV
LYVDLDLHHGDGVEEAFWYSPRVVTFSVHHASPGFFPGTGTWNMVDNDKLPIFLNGAGRG
RFSAFNLPLEEGINDLDWSNAIGPILDSLNIVIQPSYVVVQCGADCLATDPHRIFRLTNF
YPNLNLDSDCDSECSLSGYLYAIKKILSWKVPTLILGGGGYNFPDTARLWTRVTALTIEE
VKGKKMTISPEIPEHSYFSRYGPDFELDIDYFPHESHNKTLDSIQKHHRRILEQLRNYAD
LNKLIYDYDQVYQLYNLTGM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380399
n/a
NameBDBM50380399
Synonyms:CHEMBL2018302 | Tubastatin A | US8748451, 6 | US9249087, Tubacin | US9751832, Tubastatin A
TypeSmall organic molecule
Emp. Form.C20H21N3O2
Mol. Mass.335.3996
SMILESCN1CCc2c(C1)c1ccccc1n2Cc1ccc(cc1)C(=O)NO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: