| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 5A |
|---|
| Ligand | BDBM50024206 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1000±n/a nM |
|---|
| Comments | PDSP_437 |
|---|
| Citation |  Matthes, H; Boschert, U; Amlaiky, N; Grailhe, R; Plassat, JL; Muscatelli, F; Mattei, MG; Hen, R Mouse 5-hydroxytryptamine5A and 5-hydroxytryptamine5B receptors define a new family of serotonin receptors: cloning, functional expression, and chromosomal localization. Mol Pharmacol43:313-9 (1993) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine receptor 5A |
|---|
| Name: | 5-hydroxytryptamine receptor 5A |
|---|
| Synonyms: | 5-HT-5 | 5-HT-5A | 5-HT5 | 5-HT5a | 5-hydroxytryptamine receptor 5A | 5HT5A_MOUSE | 5ht5a | Htr5a | Serotonin 5a (5-HT5a) receptor | Serotonin receptor 5A |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 40749.33 |
|---|
| Organism: | MOUSE |
|---|
| Description: | 5-HT5 0 MOUSE::P30966 |
|---|
| Residue: | 357 |
|---|
| Sequence: | MDLPVNLTSFSLSTPSSLEPNRSLDTEVLRPSRPFLSAFRVLVLTLLGFLAAATFTWNLL
VLATILKVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHLEYTLRTRKRVSNVMILLTWALSTVISLAPLLFG
WGETYSEPSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWKIYRAAKFRMGSRKTNSVS
PVPEAVEVKNATQHPQMVFTVRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVLCWFP
FFVTELISPLCSWDVPAIWKSIFLWLGYSNSFFNPLIYTAFNRSYSSAFKVFFSKQQ
|
|
|
|---|
| BDBM50024206 |
|---|
| n/a |
|---|
| Name | BDBM50024206 |
|---|
| Synonyms: | 3-[2-(dimethylamino)ethyl]-1H-indol-5-ol | 3-[2-(dimethylamino)ethyl]-5-indolol | 3-[2-(dimethylamino)ethyl]indol-5-ol | 3-[beta-(dimethylamino)ethyl]-5-hydroxyindole | 5-hydroxy-N,N-dimethyltryptamine | Bufotenin | Bufotenine | CHEMBL416526 | DM5-HT | DMT,5-OH | N,N-dimethylserotonin |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H16N2O |
|---|
| Mol. Mass. | 204.2682 |
|---|
| SMILES | CN(C)CCc1c[nH]c2ccc(O)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
