Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT5B
LigandBDBM21393
Substrate/Competitorn/a
Ki 398.1±n/a nM
CommentsPDSP_205
Citation Matthes HBoschert UAmlaiky NGrailhe RPlassat JLMuscatelli FMattei MGHen R Mouse 5-hydroxytryptamine5A and 5-hydroxytryptamine5B receptors define a new family of serotonin receptors: cloning, functional expression, and chromosomal localization. Mol Pharmacol 43:313-9 (1993) [PubMed]
More Info.:Get all data from this article
 
5-HT5B
Name:5-HT5B
Synonyms:5-hydroxytryptamine receptor 5B
Type:Enzyme Catalytic Domain
Mol. Mass.:41221.13
Organism:MOUSE
Description:5-HT5B 0 MOUSE::P31387
Residue:370
Sequence:
MEVSNLSGATPGLAFPPGPESCSDSPSSGRSMGSTPGGLILPGREPPFSAFTVLVVTLLV
LLIAATFLWNLLVLVTILRVRAFHRVPHNLVASTAVSDVLVAVLVMPLSLVSELSAGRRW
QLGRSLCHVWISFDVLCCTASIWNVAAIALDRYWTITRHLQYTLRTRSRASALMIAITWA
LSALIALAPLLFGWGEAYDARLQRCQVSQEPSYAVFSTCGAFYLPLAVVLFVYWKIYKAA
KFRFGRRRRAVVPLPATTQAKEAPPESEMVFTARRRATVTFQTSGDSWREQKEKRAAMMV
GILIGVFVLCWIPFFLTELISPLCACSLPPIWKSIFLWLGYSNSFFNPLIYTAFNKNYNN
AFKSLFTKQR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21393
n/a
NameBDBM21393
Synonyms:7-(dipropylamino)-5,6,7,8-tetrahydronaphthalen-1-ol | 8-Hydroxy-2-(di-n-propylamino)tetralin | 8-OH-DPAT | 8-OH-DPAT,(+) | 8-OH-DPAT,(-) | 8-hydroxy-N,N-dipropylaminotetralin | CHEMBL1788118 | CHEMBL505765 | CHEMBL56 | DPAT | [3H]-8-OH-DPAT | cid_1220
Typeradiolabeled ligand
Emp. Form.C16H25NO
Mol. Mass.247.3758
SMILESCCCN(CCC)C1CCc2cccc(O)c2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: