Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT5B
LigandBDBM50024206
Substrate/Competitorn/a
Ki 1584.89±n/a nM
CommentsPDSP_437
Citation Matthes HBoschert UAmlaiky NGrailhe RPlassat JLMuscatelli FMattei MGHen R Mouse 5-hydroxytryptamine5A and 5-hydroxytryptamine5B receptors define a new family of serotonin receptors: cloning, functional expression, and chromosomal localization. Mol Pharmacol 43:313-9 (1993) [PubMed]
More Info.:Get all data from this article
 
5-HT5B
Name:5-HT5B
Synonyms:5-hydroxytryptamine receptor 5B
Type:Enzyme Catalytic Domain
Mol. Mass.:41221.13
Organism:MOUSE
Description:5-HT5B 0 MOUSE::P31387
Residue:370
Sequence:
MEVSNLSGATPGLAFPPGPESCSDSPSSGRSMGSTPGGLILPGREPPFSAFTVLVVTLLV
LLIAATFLWNLLVLVTILRVRAFHRVPHNLVASTAVSDVLVAVLVMPLSLVSELSAGRRW
QLGRSLCHVWISFDVLCCTASIWNVAAIALDRYWTITRHLQYTLRTRSRASALMIAITWA
LSALIALAPLLFGWGEAYDARLQRCQVSQEPSYAVFSTCGAFYLPLAVVLFVYWKIYKAA
KFRFGRRRRAVVPLPATTQAKEAPPESEMVFTARRRATVTFQTSGDSWREQKEKRAAMMV
GILIGVFVLCWIPFFLTELISPLCACSLPPIWKSIFLWLGYSNSFFNPLIYTAFNKNYNN
AFKSLFTKQR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50024206
n/a
NameBDBM50024206
Synonyms:3-[2-(dimethylamino)ethyl]-1H-indol-5-ol | 3-[2-(dimethylamino)ethyl]-5-indolol | 3-[2-(dimethylamino)ethyl]indol-5-ol | 3-[beta-(dimethylamino)ethyl]-5-hydroxyindole | 5-hydroxy-N,N-dimethyltryptamine | Bufotenin | Bufotenine | CHEMBL416526 | DM5-HT | DMT,5-OH | N,N-dimethylserotonin
TypeSmall organic molecule
Emp. Form.C12H16N2O
Mol. Mass.204.2682
SMILESCN(C)CCc1c[nH]c2ccc(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: