Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT5B
LigandBDBM21395
Substrate/Competitorn/a
Ki 1584.89±n/a nM
CommentsPDSP_1014
Citation Matthes HBoschert UAmlaiky NGrailhe RPlassat JLMuscatelli FMattei MGHen R Mouse 5-hydroxytryptamine5A and 5-hydroxytryptamine5B receptors define a new family of serotonin receptors: cloning, functional expression, and chromosomal localization. Mol Pharmacol 43:313-9 (1993) [PubMed]
More Info.:Get all data from this article
 
5-HT5B
Name:5-HT5B
Synonyms:5-hydroxytryptamine receptor 5B
Type:Enzyme Catalytic Domain
Mol. Mass.:41221.13
Organism:MOUSE
Description:5-HT5B 0 MOUSE::P31387
Residue:370
Sequence:
MEVSNLSGATPGLAFPPGPESCSDSPSSGRSMGSTPGGLILPGREPPFSAFTVLVVTLLV
LLIAATFLWNLLVLVTILRVRAFHRVPHNLVASTAVSDVLVAVLVMPLSLVSELSAGRRW
QLGRSLCHVWISFDVLCCTASIWNVAAIALDRYWTITRHLQYTLRTRSRASALMIAITWA
LSALIALAPLLFGWGEAYDARLQRCQVSQEPSYAVFSTCGAFYLPLAVVLFVYWKIYKAA
KFRFGRRRRAVVPLPATTQAKEAPPESEMVFTARRRATVTFQTSGDSWREQKEKRAAMMV
GILIGVFVLCWIPFFLTELISPLCACSLPPIWKSIFLWLGYSNSFFNPLIYTAFNKNYNN
AFKSLFTKQR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21395
n/a
NameBDBM21395
Synonyms:3-(2-(4-(4-Fluorobenzoyl)piperidinol)ethyl)-2,4(1H,3H)-quinazolinedione | 3-(2-{4-[(4-fluorophenyl)carbonyl]piperidin-1-yl}ethyl)-1,2,3,4-tetrahydroquinazoline-2,4-dione | CHEMBL1628637 | CHEMBL51 | KETANSERIN | Ketanserin | R-41,468 | R-41-468 | R41,468 | [3H]-Ketanserin
Typeradiolabeled ligand
Emp. Form.C22H22FN3O3
Mol. Mass.395.4268
SMILESFc1ccc(cc1)C(=O)C1CCN(CCn2c(=O)[nH]c3ccccc3c2=O)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: