BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase I delta/epsilon
LigandBDBM274571
Substrate/Competitorn/a
Meas. Tech.Kinase Assay
pH7.4±n/a
Temperature298.15±n/a K
IC50 0.112±n/a nM
Commentsextracted
Citation Velaparthi UDarne CPDodd DSSampognaro AJWittman MDKumaravel SMullick DLiu PRachamreddy CR Substituted imidazoles as casein kinase 1 D/E inhibitors US Patent  US9556179 Publication Date 1/31/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase I delta/epsilon
Name:Casein kinase I delta/epsilon
Synonyms:CKI-delta | CKId | CSNK1D | Casein kinase 1 delta (CK1δ) | Casein kinase I delta | Casein kinase I isoform delta (CK1D) | casein kinases 1 delta (CK1 delta)
Type:Enzyme
Mol. Mass.:47356.76
Organism:Homo sapiens (Human)
Description:P48730
Residue:415
Sequence:
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM274571
n/a
NameBDBM274571
Synonyms:(S)-2-fluoro-N-(6-(4-(4- fluorophenyl)-2-methyl-1- (1-(3,3,3-trifluoro-2- hydroxypropyl)piperidin-4- yl)-1H-imidazol-5-yl)imidazo [1,2-b]pyridazin-2- yl)isonicotinamide | US9556179, Compound 143
TypeSmall organic molecule
Emp. Form.C30H27F5N8O2
Mol. Mass.626.5798
SMILESCc1nc(c(-c2ccc3nc(NC(=O)c4ccnc(F)c4)cn3n2)n1C1CCN(C[C@H](O)C(F)(F)F)CC1)-c1ccc(F)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: