| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Heme oxygenase 1 |
|---|
| Ligand | BDBM84847 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Heme Oxygenase |
|---|
| pH | 7.4±0 |
|---|
| Temperature | 298.15±0 K |
|---|
| IC50 | 7e+2± 4e+2 nM |
|---|
| Citation |  Roman, G; Rahman, MN; Vukomanovic, D; Jia, Z; Nakatsu, K; Szarek, WA Heme oxygenase inhibition by 2-oxy-substituted 1-azolyl-4-phenylbutanes: effect of variation of the azole moiety. X-ray crystal structure of human heme oxygenase-1 in complex with 4-phenyl-1-(1H-1,2,4-triazol-1-yl)-2-butanone. Chem Biol Drug Des75:68-90 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Heme oxygenase 1 |
|---|
| Name: | Heme oxygenase 1 |
|---|
| Synonyms: | HMOX1_RAT | HSP32 | Heme Oxygenase 1 (HO-1) | Heme oxygenase 1 | Hmox1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 33005.15 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | HO-1 obtained from rat spleen was used in enzyme assays. |
|---|
| Residue: | 289 |
|---|
| Sequence: | MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHE
VGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQ
LYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRP
ASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
|
|
|
|---|
| BDBM84847 |
|---|
| n/a |
|---|
| Name | BDBM84847 |
|---|
| Synonyms: | 1-azolyl-4-phenyl-2-butanone, 49a | CHEMBL558183 |
|---|
| Type | n/a |
|---|
| Emp. Form. | C15H18N2O2 |
|---|
| Mol. Mass. | 258.3156 |
|---|
| SMILES | C(CC1(Cn2ccnc2)OCCO1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
