Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT2
LigandBDBM84935
Substrate/Competitorn/a
Ki 4.6±n/a nM
CommentsPDSP_1152
Citation Nelson DLLucaites VLAudia JENissen JSWainscott DB Species differences in the pharmacology of the 5-hydroxytryptamine2 receptor: structurally specific differentiation by ergolines and tryptamines. J Pharmacol Exp Ther 265:1272-9 (1993) [PubMed]
More Info.:Get all data from this article
 
5-HT2
Name:Serotonin 2a (5-HT2a) receptor
Synonyms:5-HT-2 | 5-HT-2A | 5-HT2A
Type:Enzyme Catalytic Domain
Mol. Mass.:52679.13
Organism:PIG
Description:5-HT2 0 0::P50129
Residue:470
Sequence:
MDVLCEENTSLSSPTNSFMQLNDDTRLYHNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHRRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGAL
LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS
SQLQTGQKENSKQDDKATENDCTMVALGKQHSEDAPADNSNTVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM84935
n/a
NameBDBM84935
Synonyms:LY 86057 | LY86057
TypeSmall organic molecule
Emp. Form.C20H26N2O3
Mol. Mass.342.432
SMILESCC(O)C(C)OC(=O)C1CC2C(Cc3c[nH]c4cccc2c34)N(C)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: