Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C, gamma
LigandBDBM3149
Substrate/CompetitorLysine-rich histone
Meas. Tech.PKC assay
IC50 10±n/a nM
Citation Defauw JMMurphy MMJagdmann GEHu HLampe JWHollinshead SPMitchell TJCrane HMHeerding JMMendoza JSDavis JEDarges JWHubbard FRHall SE Synthesis and protein kinase C inhibitory activities of acyclic balanol analogs that are highly selective for protein kinase C over protein kinase A. J Med Chem 39:5215-27 (1996) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Protein kinase C, gamma
Name:Protein kinase C, PKC; classical/novel
Synonyms:PKC gamma | PKC-gamma | Protein kinase C gamma | Protein kinase C gamma type
Type:Enzyme
Mol. Mass.:78458.05
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:697
Sequence:
MAGLGPGVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM3149
Lysine-rich histone
Name:Lysine-rich histone
Synonyms:ING Peptide | Lys-rich histone | histone type IIIS
Type:Peptide
Mol. Mass.:10508.21
Organism:Bos taurus (bovine)
Description:Purified as a lysine rich fraction of histone H1 from calf thymus.
Residue:105
Sequence:
SETAPAAPAAAPPAEKTPVKKKAAKKPAGARRKASGPPVSELITKAVAASKERSGVSLAA
LKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: