Reaction Details |
| Report a problem with these data |
Target | Calcium release-activated calcium channel protein 1 |
---|
Ligand | BDBM22914 |
---|
Substrate/Competitor | n/a |
---|
Ki | >10000±n/a nM |
---|
Comments | PDSP_1847 |
---|
Citation | Leurs, R; Tulp, MT; Menge, WM; Adolfs, MJ; Zuiderveld, OP; Timmerman, H Evaluation of the receptor selectivity of the H3 receptor antagonists, iodophenpropit and thioperamide: an interaction with the 5-HT3 receptor revealed. Br J Pharmacol116:2315-21 (1995) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Calcium release-activated calcium channel protein 1 |
---|
Name: | Calcium release-activated calcium channel protein 1 |
Synonyms: | CRACM1 | CRCM1_HUMAN | Calcium channel (VER) | Calcium release-activated calcium channel | Calcium release-activated calcium channel protein 1 | ORAI1 | Protein orai-1 | TMEM142A | Transmembrane protein 142A |
Type: | Protein |
Mol. Mass.: | 32676.63 |
Organism: | Homo sapiens (Human) |
Description: | Q96D31 |
Residue: | 301 |
Sequence: | MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSY
SEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLL
IAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFST
VIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIAST
TIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHY
A
|
|
|
BDBM22914 |
---|
n/a |
---|
Name | BDBM22914 |
Synonyms: | CHEMBL260374 | N-cyclohexyl-4-(1H-imidazol-5-yl)piperidine-1-carbothioamide | Thioperamide | US11622967, Compound Thioperamide |
Type | Small organic molecule |
Emp. Form. | C15H24N4S |
Mol. Mass. | 292.443 |
SMILES | S=C(NC1CCCCC1)N1CCC(CC1)c1cnc[nH]1 |
Structure |
|