Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetImidazoline I1
LigandBDBM22913
Substrate/Competitorn/a
Ki 530±n/a nM
CommentsPDSP_2292
Citation Leurs RTulp MTMenge WMAdolfs MJZuiderveld OPTimmerman H Evaluation of the receptor selectivity of the H3 receptor antagonists, iodophenpropit and thioperamide: an interaction with the 5-HT3 receptor revealed. Br J Pharmacol 116:2315-21 (1995) [PubMed]  Article
More Info.:Get all data from this article
 
Imidazoline I1
Name:Imidazoline I1
Synonyms:Nischarin
Type:Enzyme Catalytic Domain
Mol. Mass.:166460.59
Organism:RAT
Description:Q4G017
Residue:1502
Sequence:
MAAATLSFGPEREAEPAKEARVVGSELVDTYTVYVIQVTDGNHEWTIKHRYSDFHDLHEK
LVAERKIDKTLLPPKKIIGKNSRSLVEKREKDLEVYLQTLLKTFPDVAPRVLAHFLHFHL
YEINGVTAALAEELFEKGEQLLGAGEVFAIRPLQLYAITEQLQQGKPTCASGDAKTDLGH
ILDFTCRLKYLKVSGTEGPFGTSNIREQLLPFDLSIFKSLHQVEMSHCDAKHVRGLVTSK
PTLATMSVRFSAASMKEVLVPEASEFDEWEPEGTTLGGPVTAVIPTWQALTTLDLSHNSI
SEIDESVKLIPKIEYLDLSHNGVLVVDNLQHLYNLVHLDLSYNKLSSLEGVHTKLGNVKT
LNLAGNFLERLSGLHKLYSLVNLDLRDNRIEQLDEVKSIGNLPCLEHVALLNNPLSIIPD
YRTKVLSQFGERASEICLDDVATTEKELDTVEVLKAIQKAKDVKSKLSSTEKKVGEDFRL
PTAPCIRPSSSPPTAVPTSASLPQPILSNQGIMFVQEEALASSLSSTDSLPPDDRPIAQA
CSNSMGSLPTGQVAAEDLRDLPGAVGGVSPDHAEPEVQVVPGSGQIIFLPFTCIGYTATN
QDFIQRLSTLIRQAIERQLPAWIEAANQREEAHGEQGEEEEEEEEEDVAESRYFEMGPPD
AEEEEGSGQGEEDEEDEDEEAEEERLALEWALGADEDFLLEHIRILKVLWCFLIHVQGSI
RQFAACLVLTDFGIAVFEIPHQESRGSSQHILSSLRFVFCFPHGDLTEFGFLMPELCLVL
KVRHSENTLFIISDAANLHEFHADLRSCFAPQHMAMLCSPILYGSHTSLQEFLRQLLTFY
KVAGGSQERSQGCFPVYLVYSDKRMVQTAAGDYSGNIEWASCTLCSAVRRSCCAPSEAVK
SAAIPYWLLLTSQHLNVIKADFNPMPSRGTHNCRNRNSFKLSRVPLSTVLLDPTRSCTQP
RGAFADGHVLELLVGYRFVTAIFVLPHEKFHFLRVYNQLRASLKDLKTVVIAKNPSARPR
TQGPLAGGQPAKSRVSAEQRLQETPAEAPAPAPAAAESAAEAPAAAEASAPAGAPAPAGA
PAPAGAPAGAQAPAPAQAEVPAQYPSERLIQSTSEENQIPSHLPVCPSLQHIARLRGRAI
IDLFHSSIAEVENEELRHLLWSSVVFYQTPGLEVTACVLLSTKAVYFILHDGLRRYFSEP
LQDFWHQKNTDYNNSPFHISQCFVLKLSDLQSVNVGLFDQYFRLTGSSPTQVVTCLTRDS
YLTHCFLQHLMLVLSSLERTPSPEPIDKDFYSEFGDKNTGKMENYELIHSSRVKFTYPSE
EEVGDLTYVVAQKMADPAKNPALSILLYIQAFQVITPQLGRGRGPLRPKTLLLTSAEIFL
LDEDYIHYPLPEFAKEPPQRDRYRLDDGRRVRDLDRVLMGYNPYPQALTLVFDDTQGHDL
MGSVTLDHFGEMPGGPGRAGQGREVQWQVFVPSAESREKLISLLARQWEALCGRELPVEL
TG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22913
n/a
NameBDBM22913
Synonyms:CHEMBL1237146 | CHEMBL498770 | Iodophenpropit | {[3-(1H-imidazol-5-yl)propyl]sulfanyl}-N''-[2-(4-iodophenyl)ethyl]methanimidamide
TypeSmall organic molecule
Emp. Form.C15H19IN4S
Mol. Mass.414.308
SMILESNC(SCCCc1cnc[nH]1)=NCCc1ccc(I)cc1 |w:11.12|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: