| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM22914 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 180±n/a nM |
|---|
| Comments | PDSP_1847 |
|---|
| Citation |  Leurs, R; Tulp, MT; Menge, WM; Adolfs, MJ; Zuiderveld, OP; Timmerman, H Evaluation of the receptor selectivity of the H3 receptor antagonists, iodophenpropit and thioperamide: an interaction with the 5-HT3 receptor revealed. Br J Pharmacol116:2315-21 (1995) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM22914 |
|---|
| n/a |
|---|
| Name | BDBM22914 |
|---|
| Synonyms: | CHEMBL260374 | N-cyclohexyl-4-(1H-imidazol-5-yl)piperidine-1-carbothioamide | Thioperamide | US11622967, Compound Thioperamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H24N4S |
|---|
| Mol. Mass. | 292.443 |
|---|
| SMILES | S=C(NC1CCCCC1)N1CCC(CC1)c1cnc[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
