Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin receptor 2a and 2b (5HT2A and 5HT2B)
LigandBDBM30853
Substrate/Competitorn/a
Ki 5.65±n/a nM
CommentsPDSP_146
Citation Wainscott DBLucaites VLKursar JDBaez MNelson DL Pharmacologic characterization of the human 5-hydroxytryptamine2B receptor: evidence for species differences. J Pharmacol Exp Ther 276:720-7 (1996) [PubMed]
More Info.:Get all data from this article
 
Serotonin receptor 2a and 2b (5HT2A and 5HT2B)
Name:Serotonin receptor 2a and 2b (5HT2A and 5HT2B)
Synonyms:5-HT2B | 5-hydroxytryptamine receptor 2B | HTR2B | Serotonin 2b (5-HT2b) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:53668.47
Organism:RAT
Description:5-HT2B HTR2B RAT::P30994
Residue:479
Sequence:
MASSYKMSEQSTISEHILQKTCDHLILTDRSGLKAESAAEEMKQTAENQGNTVHWAALLI
FAVIIPTIGGNILVILAVSLEKRLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEATW
PLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQANQCNSRTTAFVKITVVWL
ISIGIAIPVPIKGIEADVVNAHNITCELTKDRFGSFMLFGSLAAFFAPLTIMIVTYFLTI
HALRKKAYLVRNRPPQRLTRWTVSTVLQREDSSFSSPEKMVMLDGSHKDKILPNSTDETL
MRRMSSAGKKPAQTISNEQRASKVLGIVFLFFLLMWCPFFITNVTLALCDSCNQTTLKTL
LQIFVWVGYVSSGVNPLIYTLFNKTFREAFGRYITCNYQATKSVKVLRKCSSTLYFGNSM
VENSKFFTKHGIRNGINPAMYQSPVRLRSSTIQSSSIILLNTFLTENDGDKVEDQVSYI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM30853
n/a
NameBDBM30853
Synonyms:2-(5-fluoranyl-1H-indol-3-yl)ethanamine;hydrochloride | 2-(5-fluoro-1H-indol-3-yl)ethanamine;hydrochloride | 2-(5-fluoro-1H-indol-3-yl)ethylamine;hydrochloride | 5-F-T | CHEMBL275628 | MLS000047815 | SMR000033820 | cid_197774
TypeSmall organic molecule
Emp. Form.C10H11FN2
Mol. Mass.178.2061
SMILESNCCc1c[nH]c2ccc(F)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: