Reaction Details |
| Report a problem with these data |
Target | Pro-neuropeptide Y |
---|
Ligand | BDBM50015490 |
---|
Substrate/Competitor | n/a |
---|
Ki | 1000±n/a nM |
---|
Comments | PDSP_1377 |
---|
Citation | Yan, H; Yang, J; Marasco, J; Yamaguchi, K; Brenner, S; Collins, F; Karbon, W Cloning and functional expression of cDNAs encoding human and rat pancreatic polypeptide receptors. Proc Natl Acad Sci U S A93:4661-5 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Pro-neuropeptide Y |
---|
Name: | Pro-neuropeptide Y |
Synonyms: | NPY_RAT | Neuropeptide Y | Npy | Pro-neuropeptide Y |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11033.13 |
Organism: | RAT |
Description: | Neuropeptide Y 0 RAT::P07808 |
Residue: | 98 |
Sequence: | MMLGNKRMGLCGLTLALSLLVCLGILAEGYPSKPDNPGEDAPAEDMARYYSALRHYINLI
TRQRYGKRSSPETLISDLLMRESTENAPRTRLEDPSMW
|
|
|
BDBM50015490 |
---|
n/a |
---|
Name | BDBM50015490 |
Synonyms: | CHEMBL438945 | H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 | NPY | NPY, human | NPY, human, rat | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro- Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His- Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (NPY) | human Neuropeptide Y |
Type | Small organic molecule |
Emp. Form. | C189H285N55O57S |
Mol. Mass. | 4271.685 |
SMILES | n/a |
Structure |
|