Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y
LigandBDBM50015490
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_1377
Citation Yan HYang JMarasco JYamaguchi KBrenner SCollins FKarbon W Cloning and functional expression of cDNAs encoding human and rat pancreatic polypeptide receptors. Proc Natl Acad Sci U S A 93:4661-5 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
Neuropeptide Y
Name:Neuropeptide Y
Synonyms:Pro-neuropeptide Y
Type:Enzyme Catalytic Domain
Mol. Mass.:11033.13
Organism:RAT
Description:Neuropeptide Y 0 RAT::P07808
Residue:98
Sequence:
MMLGNKRMGLCGLTLALSLLVCLGILAEGYPSKPDNPGEDAPAEDMARYYSALRHYINLI
TRQRYGKRSSPETLISDLLMRESTENAPRTRLEDPSMW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50015490
n/a
NameBDBM50015490
Synonyms:CHEMBL438945 | H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 | NPY | NPY, human | NPY, human, rat | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro- Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His- Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (NPY) | human Neuropeptide Y
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: