Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y
LigandBDBM82300
Substrate/Competitorn/a
Ki 0.4±n/a nM
CommentsPDSP_1512
Citation Yan HYang JMarasco JYamaguchi KBrenner SCollins FKarbon W Cloning and functional expression of cDNAs encoding human and rat pancreatic polypeptide receptors. Proc Natl Acad Sci U S A 93:4661-5 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
Neuropeptide Y
Name:Neuropeptide Y
Synonyms:Pro-neuropeptide Y
Type:Enzyme Catalytic Domain
Mol. Mass.:11033.13
Organism:RAT
Description:Neuropeptide Y 0 RAT::P07808
Residue:98
Sequence:
MMLGNKRMGLCGLTLALSLLVCLGILAEGYPSKPDNPGEDAPAEDMARYYSALRHYINLI
TRQRYGKRSSPETLISDLLMRESTENAPRTRLEDPSMW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82300
n/a
NameBDBM82300
Synonyms:CAS_59763-91-6 | NSC_41735 | PP, rat
TypeSmall organic molecule
Emp. Form.C195H302N58O57S
Mol. Mass.4402.902
SMILESn/a
Structure