| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Pro-neuropeptide Y |
|---|
| Ligand | BDBM82299 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 7.4±n/a nM |
|---|
| Comments | PDSP_1558 |
|---|
| Citation |  Yan, H; Yang, J; Marasco, J; Yamaguchi, K; Brenner, S; Collins, F; Karbon, W Cloning and functional expression of cDNAs encoding human and rat pancreatic polypeptide receptors. Proc Natl Acad Sci U S A93:4661-5 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Pro-neuropeptide Y |
|---|
| Name: | Pro-neuropeptide Y |
|---|
| Synonyms: | NPY_RAT | Neuropeptide Y | Npy | Pro-neuropeptide Y |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11033.13 |
|---|
| Organism: | RAT |
|---|
| Description: | Neuropeptide Y 0 RAT::P07808 |
|---|
| Residue: | 98 |
|---|
| Sequence: | MMLGNKRMGLCGLTLALSLLVCLGILAEGYPSKPDNPGEDAPAEDMARYYSALRHYINLI
TRQRYGKRSSPETLISDLLMRESTENAPRTRLEDPSMW
|
|
|
|---|
| BDBM82299 |
|---|
| n/a |
|---|
| Name | BDBM82299 |
|---|
| Synonyms: | PYY Pro34, Human |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C194H293N53O57 |
|---|
| Mol. Mass. | 4279.7231 |
|---|
| SMILES | n/a |
|---|
| Structure | 
|
|---|
Search and Browse
