Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y receptor type 5 (NPY Y5)
LigandBDBM50015490
Substrate/Competitorn/a
Ki 4.3±n/a nM
CommentsPDSP_1370
Citation Weinberg DHSirinathsinghji DJTan CPShiao LLMorin NRigby MRHeavens RHRapoport DRBayne MLCascieri MAStrader CDLinemeyer DLMacNeil DJ Cloning and expression of a novel neuropeptide Y receptor. J Biol Chem 271:16435-8 (1996) [PubMed]
More Info.:Get all data from this article
 
Neuropeptide Y receptor type 5 (NPY Y5)
Name:Neuropeptide Y receptor type 5 (NPY Y5)
Synonyms:NPY-Y5 | Neuropeptide Y receptor Y5
Type:Enzyme
Mol. Mass.:52807.91
Organism:Mus musculus (Mouse)
Description:O70342
Residue:466
Sequence:
MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDD
LQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTL
TSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFL
IATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQ
YILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSY
SFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVK
PEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISN
RHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50015490
n/a
NameBDBM50015490
Synonyms:CHEMBL438945 | H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 | NPY | NPY, human | NPY, human, rat | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro- Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His- Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (NPY) | human Neuropeptide Y
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: