Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGABA A receptor alpha-6/beta-2/gamma-2
LigandBDBM26263
Substrate/Competitorn/a
Ki 270.36±n/a nM
CommentsPDSP_1609
Citation Yang WDrewe JALan NC Cloning and characterization of the human GABAA receptor alpha 4 subunit: identification of a unique diazepam-insensitive binding site. Eur J Pharmacol 291:319-25 (1995) [PubMed]  Article
More Info.:Get all data from this article
 
GABA A receptor alpha-6/beta-2/gamma-2
Name:Gamma-aminobutyric acid receptor subunit alpha-6/beta-3
Synonyms:GABA A Alpha6Beta2Gamma2 | GABA A Alpha6Beta3Gamma2 | GABA A alpha6 | GABA receptor alpha-6 subunit | Gamma-aminobutyric acid receptor subunit alpha-6
Type:Enzyme Catalytic Domain
Mol. Mass.:51029.60
Organism:Homo sapiens (Human)
Description:GABA A alpha6 0 HUMAN::Q16445
Residue:453
Sequence:
MASSLPWLCIILWLENALGKLEVEGNFYSENVSRILDNLLEGYDNRLRPGFGGAVTEVKT
DIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLKFGGPTEILSLNNLMVSKIWTPDTFFRN
GKKSIAHNMTTPNKLFRIMQNGTILYTMRLTINADCPMRLVNFPMDGHACPLKFGSYAYP
KSEIIYTWKKGPLYSVEVPEESSSLLQYDLIGQTVSSETIKSNTGEYVIMTVYFHLQRKM
GYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHSLPKVSYA
TAMDWFIAVCFAFVFSALIEFAAVNYFTNLQTQKAKRKAQFAAPPTVTISKATEPLEAEI
VLHPDSKYHLKKRITSLSLPIVSSSEANKVLTRAPILQSTPVTPPPLSPAFGGTSKIDQY
SRILFPVAFAGFNLVYWVVYLSKDTMEVSSSVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26263
n/a
NameBDBM26263
Synonyms:Anexate | CHEMBL407 | FLUMAZENIL | Ro15-1788 | Romazicon | [3H]Ro15-1788 | ethyl 12-fluoro-8-methyl-9-oxo-2,4,8-triazatricyclo[8.4.0.0^{2,6}]tetradeca-1(14),3,5,10,12-pentaene-5-carboxylate
TypeSmall organic molecule
Emp. Form.C15H14FN3O3
Mol. Mass.303.2884
SMILESCCOC(=O)c1ncn-2c1CN(C)C(=O)c1cc(F)ccc-21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: