Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCCKBR
LigandBDBM21147
Substrate/Competitorn/a
Ki 0.1±n/a nM
CommentsPDSP_2196
Citation Akiyama TTachibana IHirohata YShirohara HYamamoto MOtsuki M Pharmacological profile of TP-680, a new cholecystokininA receptor antagonist. Br J Pharmacol 117:1558-64 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
CCKBR
Name:Cholecystokinin receptor
Synonyms:Cholecystokinin A | Gastrin/cholecystokinin type B receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:48980.43
Organism:RAT
Description:Cholecystokinin A CCKBR RAT::P30553
Residue:452
Sequence:
MELLKLNRSVQGPGPGSGSSLCRPGVSLLNSSSAGNLSCDPPRIRGTGTRELEMAIRITL
YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAISYLMGVSVSVSTLNLVAIALERYSAICRPLQARVWQTRSHAARVILATWL
LSGLLMVPYPVYTMVQPVGPRVLQCMHRWPSARVQQTWSVLLLLLLFFIPGVVIAVAYGL
ISRELYLGLHFDGENDSETQSRARNQGGLPGGAAPGPVHQNGGCRPVTSVAGEDSDGCCV
QLPRSRLEMTTLTTPTPGPVPGPRPNQAKLLAKKRVVRMLLVIVLLFFLCWLPVYSVNTW
RAFDGPGAQRALSGAPISFIHLLSYVSACVNPLVYCFMHRRFRQACLDTCARCCPRPPRA
RPQPLPDEDPPTPSIASLSRLSYTTISTLGPG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21147
n/a
NameBDBM21147
Synonyms:(3S)-3-[(2S)-2-[(2S)-2-{2-[(2S)-2-[(2S)-2-[(3S)-3-amino-3-formamidopropanoic acid]-3-[4-(sulfooxy)phenyl]propanamido]-4-(methylsulfanyl)butanamido]acetamido}-3-(1H-indol-3-yl)propanamido]-4-(methylsulfanyl)butanamido]-3-{[(1S)-1-carbamoyl-2-phenylethyl]carbamoyl}propanoic acid | CCK-8 | CCK-8(SO3) | CHEMBL1121 | H-Asp-Tyr(SO3H)-Met-Gly-Trp-Met-Asp-Phe-NH2 | SINCALIDE | Syncalide | [125I]CCK-8
Typeradiolabeled ligand
Emp. Form.C49H62N10O16S3
Mol. Mass.1143.269
SMILESCSCC[C@H](NC(=O)[C@H](Cc1ccc(OS(O)(=O)=O)cc1)NC(=O)[C@@H](N)CC(O)=O)C(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: