Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-glucosidase MAL12
LigandBDBM84963
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Ki 1.05e+4± 2e+2 nM
IC50 1.95e+4± 3e+2 nM
Citation Kim JYLee JWKim YSLee YRyu YBKim SRyu HWCurtis-Long MJLee KWLee WSPark KH A novel competitive class of α-glucosidase inhibitors: (E)-1-phenyl-3-(4-styrylphenyl)urea derivatives. Chembiochem 11:2125-31 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-glucosidase MAL12
Name:Alpha-glucosidase MAL12
Synonyms:α-Glucosidase | Maltase | alpha-Glucosidase (α-Glucosidase)
Type:Protein
Mol. Mass.:68084.32
Organism:Saccharomyces cerevisiae
Description:P53341
Residue:584
Sequence:
MTISDHPETEPKWWKEATIYQIYPASFKDSNNDGWGDLKGITSKLQYIKDLGVDAIWVCP
FYDSPQQDMGYDISNYEKVWPTYGTNEDCFELIDKTHKLGMKFITDLVINHCSTEHEWFK
ESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSFFGGSAWTFDETTNEFYLRLFASR
QVDLNWENEDCRRAIFESAVGFWLDHGVDGFRIDTAGLYSKRPGLPDSPIFDKTSKLQHP
NWGSHNGPRIHEYHQELHRFMKNRVKDGREIMTVGEVAHGSDNALYTSAARYEVSEVFSF
THVEVGTSPFFRYNIVPFTLKQWKEAIASNFLFINGTDSWATTYIENHDQARSITRFADD
SPKYRKISGKLLTLLECSLTGTLYVYQGQEIGQINFKEWPIEKYEDVDVKNNYEIIKKSF
GKNSKEMKDFFKGIALLSRDHSRTPMPWTKDKPNAGFTGPDVKPWFLLNESFEQGINVEQ
ESRDDDSVLNFWKRALQARKKYKELMIYGYDFQFIDLDSDQIFSFTKEYEDKTLFAALNF
SGEEIEFSLPREGASLSFILGNYDDTDVSSRVLKPWEGRIYLVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM84963
n/a
NameBDBM84963
Synonyms:Urea derivative, 7
TypeSmall organic molecule
Emp. Form.C22H20N2O4
Mol. Mass.376.4052
SMILESCOc1ccc(NC(=O)Nc2ccc(\C=C\c3ccc(O)c(O)c3)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: