Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-glucosidase MAL12
LigandBDBM18351
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Ki 1.80e+4± 1.2e+3 nM
IC50 3.95e+4± 5e+2 nM
Citation Kim JYLee JWKim YSLee YRyu YBKim SRyu HWCurtis-Long MJLee KWLee WSPark KH A novel competitive class of α-glucosidase inhibitors: (E)-1-phenyl-3-(4-styrylphenyl)urea derivatives. Chembiochem 11:2125-31 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-glucosidase MAL12
Name:Alpha-glucosidase MAL12
Synonyms:α-Glucosidase | Maltase | alpha-Glucosidase (α-Glucosidase)
Type:Protein
Mol. Mass.:68084.32
Organism:Saccharomyces cerevisiae
Description:P53341
Residue:584
Sequence:
MTISDHPETEPKWWKEATIYQIYPASFKDSNNDGWGDLKGITSKLQYIKDLGVDAIWVCP
FYDSPQQDMGYDISNYEKVWPTYGTNEDCFELIDKTHKLGMKFITDLVINHCSTEHEWFK
ESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSFFGGSAWTFDETTNEFYLRLFASR
QVDLNWENEDCRRAIFESAVGFWLDHGVDGFRIDTAGLYSKRPGLPDSPIFDKTSKLQHP
NWGSHNGPRIHEYHQELHRFMKNRVKDGREIMTVGEVAHGSDNALYTSAARYEVSEVFSF
THVEVGTSPFFRYNIVPFTLKQWKEAIASNFLFINGTDSWATTYIENHDQARSITRFADD
SPKYRKISGKLLTLLECSLTGTLYVYQGQEIGQINFKEWPIEKYEDVDVKNNYEIIKKSF
GKNSKEMKDFFKGIALLSRDHSRTPMPWTKDKPNAGFTGPDVKPWFLLNESFEQGINVEQ
ESRDDDSVLNFWKRALQARKKYKELMIYGYDFQFIDLDSDQIFSFTKEYEDKTLFAALNF
SGEEIEFSLPREGASLSFILGNYDDTDVSSRVLKPWEGRIYLVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18351
n/a
NameBDBM18351
Synonyms:(2R,3R,4R,5S)-2-(Hydroxymethyl)piperidine-3,4,5-triol, 10 | (2R,3R,4R,5S)-2-(hydroxymethyl)piperidine-3,4,5-triol | 1-Deoxynojirimycin | 1-deoxynojirimycin (DNJ) | CHEMBL307429 | US9181184, 1 | dNM
Typenatural product
Emp. Form.C6H13NO4
Mol. Mass.163.1717
SMILESOC[C@H]1NC[C@H](O)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: