Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNPY5R
LigandBDBM50015490
Substrate/Competitorn/a
Ki 0.5±n/a nM
CommentsPDSP_1378
Citation Hu YBloomquist BTCornfield LJDeCarr LBFlores-Riveros JRFriedman LJiang PLewis-Higgins LSadlowski YSchaefer JVelazquez NMcCaleb ML Identification of a novel hypothalamic neuropeptide Y receptor associated with feeding behavior. J Biol Chem 271:26315-9 (1996) [PubMed]
More Info.:Get all data from this article
 
NPY5R
Name:Neuropeptide Y receptor type 5
Synonyms:NPY-Y5 | Neuropeptide Y receptor type 5
Type:Enzyme Catalytic Domain
Mol. Mass.:50435.58
Organism:Rat 6B
Description:NPY-Y5 NPY5R Rat 6B::Q63634
Residue:445
Sequence:
MEFKLEEHFNKTFVTENNTAAARNAAFPAWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNL
LILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKAMCHIMPFL
QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL
VELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC
GLSHKENRLEENEMINLTLQPSKKSRNQAKTPSTQKWSYSFIRKHRRRYSKKTACVLPAP
AGPSQGKHLAVPENPASVRSQLSPSSKVIPGVPICFEVKPEESSDAHEMRVKRSITRIKK
RSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLN
PILYGFLNNGIKADLRALIHCLHMS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50015490
n/a
NameBDBM50015490
Synonyms:CHEMBL438945 | H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 | NPY | NPY, human | NPY, human, rat | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro- Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His- Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (NPY) | human Neuropeptide Y
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: