Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR4
LigandBDBM84648
Substrate/Competitorn/a
Ki 25.11±n/a nM
CommentsPDSP_400
Citation Ansanay HSebben MBockaert JDumuis A Pharmacological comparison between [3H]GR 113808 binding sites and functional 5-HT4 receptors in neurons. Eur J Pharmacol 298:165-74 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
HTR4
Name:HTR4
Synonyms:5-HT-4 | 5-HT4 | 5-HT4L | 5-hydroxytryptamine receptor 4 | Serotonin 4 (5-HT4) receptor | Serotonin receptor 4
Type:Enzyme Catalytic Domain
Mol. Mass.:43970.99
Organism:MOUSE
Description:5-HT4 HTR4 MOUSE::P97288
Residue:388
Sequence:
MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSN
STWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRP
QPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVDPFIDYTVPEQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPILGQTVPCSTTTINGSTHVLRD
TVECGGQWESRCHLTATSPLVAAQPSDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM84648
n/a
NameBDBM84648
Synonyms:BIMU 8
TypeSmall organic molecule
Emp. Form.C19H26N4O2
Mol. Mass.342.4353
SMILESCC(C)n1c2ccccc2n(C(=O)NC2C[C@@H]3CC[C@H](C2)N3C)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: