| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50049750 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_218 |
|---|
| Citation |  Sullivan, JP; Donnelly-Roberts, D; Briggs, CA; Anderson, DJ; Gopalakrishnan, M; Piattoni-Kaplan, M; Campbell, JE; McKenna, DG; Molinari, E; Hettinger, AM; Garvey, DS; Wasicak, JT; Holladay, MW; Williams, M; Arneric, SP A-85380 [3-(2(S)-azetidinylmethoxy) pyridine]: in vitro pharmacological properties of a novel, high affinity alpha 4 beta 2 nicotinic acetylcholine receptor ligand. Neuropharmacology35:725-34 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50049750 |
|---|
| n/a |
|---|
| Name | BDBM50049750 |
|---|
| Synonyms: | (S)-3-(azetidin-2-ylmethoxy)pyridine | 3-((S)-1-Azetidin-2-ylmethoxy)-pyridine | A-159470 | A-85380 | CHEMBL59986 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H12N2O |
|---|
| Mol. Mass. | 164.2044 |
|---|
| SMILES | C(Oc1cccnc1)[C@@H]1CCN1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
