Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHRH3
LigandBDBM22567
Substrate/Competitorn/a
Ki 7943.28±n/a nM
CommentsPDSP_1202
Citation Brown JDO'Shaughnessy CTKilpatrick GJScopes DIBeswick PClitherow JWBarnes JC Characterisation of the specific binding of the histamine H3 receptor antagonist radioligand [3H]GR168320. Eur J Pharmacol 311:305-10 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
HRH3
Name:HRH3
Synonyms:HISTAMINE H3 | Hrh3 protein
Type:Enzyme Catalytic Domain
Mol. Mass.:37860.96
Organism:RAT
Description:Q5PPG3
Residue:344
Sequence:
MERAPPDGLMNASGTLAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRGSKPSASSASLEKRMKMVSQSITQRF
RLSRDKKVAKSLAIIVSIFGLCWAPYTLLMIIRAACHGRCIPDY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22567
n/a
NameBDBM22567
Synonyms:3H]pyrilamine | CHEMBL511 | Dorantamin | MEPYRAMINE | Mepyramine | N-(4-methoxybenzyl)-N ,N -dimethyl-N-pyridin-2-ylethane-1,2-diamine | N-[2-(dimethylamino)ethyl]-N-[(4-methoxyphenyl)methyl]pyridin-2-amine | PYRILAMINE | Pyranisamine | [3H]mepyramine | [3H]pyrilamine
Typeradiolabeled ligand
Emp. Form.C17H23N3O
Mol. Mass.285.384
SMILESCOc1ccc(CN(CCN(C)C)c2ccccn2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: