Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHRH3
LigandBDBM22893
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_1588
Citation Brown JDO'Shaughnessy CTKilpatrick GJScopes DIBeswick PClitherow JWBarnes JC Characterisation of the specific binding of the histamine H3 receptor antagonist radioligand [3H]GR168320. Eur J Pharmacol 311:305-10 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
HRH3
Name:HRH3
Synonyms:HISTAMINE H3 | Hrh3 protein
Type:Enzyme Catalytic Domain
Mol. Mass.:37860.96
Organism:RAT
Description:Q5PPG3
Residue:344
Sequence:
MERAPPDGLMNASGTLAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRGSKPSASSASLEKRMKMVSQSITQRF
RLSRDKKVAKSLAIIVSIFGLCWAPYTLLMIIRAACHGRCIPDY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22893
n/a
NameBDBM22893
Synonyms:CHEMBL512 | Ranitidine | ZANTAC | dimethyl[(5-{[(2-{[(E)-1-(methylamino)-2-nitroethenyl]amino}ethyl)sulfanyl]methyl}furan-2-yl)methyl]amine
TypeSmall organic molecule
Emp. Form.C13H22N4O3S
Mol. Mass.314.404
SMILESCN\C([CH-][N+]([O-])=O)=[NH+]/CCSCc1ccc(CN(C)C)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: