Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 2A
LigandBDBM50001786
Substrate/Competitorn/a
Ki 0.39±n/a nM
CommentsPDSP_1709
Citation Schotte AJanssen PFGommeren WLuyten WHVan Gompel PLesage ASDe Loore KLeysen JE Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl) 124:57-73 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
5-hydroxytryptamine receptor 2A
Name:Dopamine D2 receptor and serotonin 2a receptor
Synonyms:5-HT-2 | 5-HT-2A | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT-2A) | 5-hydroxytryptamine receptor 2A (5HT-2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | HTR2 | HTR2A | Serotonin receptor 2A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52607.65
Organism:Homo sapiens (Human)
Description:n/a
Residue:471
Sequence:
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001786
n/a
NameBDBM50001786
Synonyms:1-(2-{4-[5-chloro-1-(4-fluorophenyl)-1H-indol-3-yl]piperidin-1-yl}ethyl)imidazolidin-2-one | 1-[2-[4-[5-chloro-1-(4-fluorophenyl)-indol-3-yl]-1-piperidyl]ethyl]imidazolidin-2-one | CHEMBL12713 | Sertindole
TypeSmall organic molecule
Emp. Form.C24H26ClFN4O
Mol. Mass.440.941
SMILESFc1ccc(cc1)-n1cc(C2CCN(CCN3CCNC3=O)CC2)c2cc(Cl)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: