Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDOPAMINE
LigandBDBM81927
Substrate/Competitorn/a
Ki 0.63±n/a nM
CommentsPDSP_1491
Citation Schotte AJanssen PFGommeren WLuyten WHVan Gompel PLesage ASDe Loore KLeysen JE Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl) 124:57-73 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
DOPAMINE
Name:Dopamine receptors; D1 & D2
Synonyms:D(1A) dopamine receptor | DOPAMINE D1 | Dopamine D1 high | Dopamine D1 low | Dopamine receptor | Dopamine receptor D1 | Dopamine1-like
Type:Enzyme Catalytic Domain
Mol. Mass.:49429.75
Organism:RAT
Description:DOPAMINE 0 RAT::P18901
Residue:446
Sequence:
MAPNTSTMDEAGLPAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNF
FVISLAVSDLLVAVLVMPWKAVAEIAGFWPLGPFCNIWVAFDIMCSTASILNLCVISVDR
YWAISSPFQYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTWPLDGNFTSLED
TEDDNCDTRLSRTYAISSSLISFYIPVAIMIVTYTSIYRIAQKQIRRISALERAAVHAKN
CQTTAGNGNPVECAQSESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFISNCMVPFCGS
EETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFQKAFSTLLGCYRLCPTTNNAIET
VSINNNGAVVFSSHHEPRGSISKDCNLVYLIPHAVGSSEDLKKEEAGGIAKPLEKLSPAL
SVILDYDTDVSLEKIQPVTHSGQHST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81927
n/a
NameBDBM81927
Synonyms:CAS_60756-96-9 | Lu 12-331 | Pifluthixol
TypeSmall organic molecule
Emp. Form.C24H25F4NOS
Mol. Mass.451.52
SMILESOCCC1CCN(CC\C=C2\c3ccc(F)cc3Sc3ccc(cc23)C(F)(F)F)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: