Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCysteinyl leukotriene receptor 1
LigandBDBM50009075
Substrate/Competitorn/a
Ki 0.24±n/a nM
CommentsPDSP_953
Citation Schotte AJanssen PFGommeren WLuyten WHVan Gompel PLesage ASDe Loore KLeysen JE Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl) 124:57-73 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
Cysteinyl leukotriene receptor 1
Name:Cysteinyl leukotriene receptor 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:39007.58
Organism:GUINEA PIG
Description:Leukotriene D4 0 GUINEA PIG::Q2NNR5
Residue:340
Sequence:
MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSA
FQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAM
SFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPP
QDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIV
VTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFF
SGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009075
n/a
NameBDBM50009075
Synonyms:CHEMBL22033 | ICI 198615 | ICI-198615 | [1-(4-Benzenesulfonylaminocarbonyl-2-methoxy-benzyl)-1H-indazol-5-yl]-carbamic acid cyclopentyl ester | [1-(4-Benzenesulfonylaminocarbonyl-2-methoxy-benzyl)-1H-indazol-6-yl]-carbamic acid cyclopentyl ester | [1-(4-Benzenesulfonylaminocarbonyl-2-methoxy-benzyl)-1H-indazol-6-yl]-carbamic acid cyclopentyl ester (ICI 198,615) | [1-(4-Benzenesulfonylaminocarbonyl-2-methoxy-benzyl)-1H-indazol-6-yl]-carbamic acid cyclopentyl ester(ICI 198, 615) | [1-(4-Benzenesulfonylaminocarbonyl-2-methoxy-benzyl)-1H-indazol-6-yl]-carbamic acid cyclopentyl ester(ICI 198615)
TypeSmall organic molecule
Emp. Form.C28H28N4O6S
Mol. Mass.548.61
SMILESCOc1cc(ccc1Cn1ncc2ccc(NC(=O)OC3CCCC3)cc12)C(=O)NS(=O)(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: