| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM26948 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 77±n/a nM |
|---|
| Comments | PDSP_843 |
|---|
| Citation |  Schotte, A; Janssen, PF; Gommeren, W; Luyten, WH; Van Gompel, P; Lesage, AS; De Loore, K; Leysen, JE Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl)124:57-73 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | OPRM_RAT | Opiate non-selective | Opioid receptor B | Oprm1 | Ror-b |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44503.11 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor. |
|---|
| Residue: | 398 |
|---|
| Sequence: | MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
|
|
|
|---|
| BDBM26948 |
|---|
| n/a |
|---|
| Name | BDBM26948 |
|---|
| Synonyms: | 8-[4,4-bis(4-fluorophenyl)butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | CHEMBL46516 | FLUSPIRILENE | NCGC00015424 | cid_3396 | med.21724, Compound Fluspirilene | spiropiperidine analogue, 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H31F2N3O |
|---|
| Mol. Mass. | 475.5727 |
|---|
| SMILES | Fc1ccc(cc1)C(CCCN1CCC2(CC1)N(CNC2=O)c1ccccc1)c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
