| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM81924 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 0.58±n/a nM |
|---|
| Comments | PDSP_93 |
|---|
| Citation |  Schotte, A; Janssen, PF; Gommeren, W; Luyten, WH; Van Gompel, P; Lesage, AS; De Loore, K; Leysen, JE Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl)124:57-73 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM81924 |
|---|
| n/a |
|---|
| Name | BDBM81924 |
|---|
| Synonyms: | (R)-3-(1-Propyl-piperidin-3-yl)-phenol | 3PPP(+/-) | CAS_85976-54-1 | CHEMBL276500 | NSC_202477 | PPP, R(+)-3 | PPP, S(-)-3 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H21NO |
|---|
| Mol. Mass. | 219.3226 |
|---|
| SMILES | CCCN1CCCC(C1)c1cccc(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
