Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSubstance P
LigandBDBM84994
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_1422
Citation Schotte AJanssen PFGommeren WLuyten WHVan Gompel PLesage ASDe Loore KLeysen JE Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl) 124:57-73 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
Substance P
Name:Substance P
Synonyms:Protachykinin-1
Type:Enzyme Catalytic Domain
Mol. Mass.:15006.99
Organism:Homo sapiens (Human)
Description:Substance P 0 HUMAN::P20366
Residue:129
Sequence:
MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPK
PQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERS
AMQNYERRR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM84994
n/a
NameBDBM84994
Synonyms:CAS_163091 | NSC_163091 | ORG-5222
TypeSmall organic molecule
Emp. Form.C17H16ClNO
Mol. Mass.285.768
SMILESCN1CC2C(C1)c1cc(Cl)ccc1Oc1ccccc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: