| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Type-1 angiotensin II receptor |
|---|
| Ligand | BDBM21398 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_918 |
|---|
| Citation |  Schoemaker, H; Claustre, Y; Fage, D; Rouquier, L; Chergui, K; Curet, O; Oblin, A; Gonon, F; Carter, C; Benavides, J; Scatton, B Neurochemical characteristics of amisulpride, an atypical dopamine D2/D3 receptor antagonist with both presynaptic and limbic selectivity. J Pharmacol Exp Ther280:83-97 (1997) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Type-1 angiotensin II receptor |
|---|
| Name: | Type-1 angiotensin II receptor |
|---|
| Synonyms: | AGTR1 | AGTR1_RABIT | ANGIOTENSIN AT1 | Angiotensin II receptor | Angiotensin II type 1a (AT-1a) receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 41009.15 |
|---|
| Organism: | RABBIT |
|---|
| Description: | ANGIOTENSIN AT1 AGTR1 RABBIT::P34976 |
|---|
| Residue: | 359 |
|---|
| Sequence: | MMLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLAVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCRIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSSKKPVPCFEVE
|
|
|
|---|
| BDBM21398 |
|---|
| n/a |
|---|
| Name | BDBM21398 |
|---|
| Synonyms: | 4-[4-(4-Chloro-phenyl)-4-hydroxy-piperidin-1-yl]-1-(4-fluoro-phenyl)-butan-1-one;propionate(HCl) | 4-[4-(4-chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one | CHEMBL54 | CHEMBL545608 | Haloperidol | Haloperidol, 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H23ClFNO2 |
|---|
| Mol. Mass. | 375.864 |
|---|
| SMILES | OC1(CCN(CCCC(=O)c2ccc(F)cc2)CC1)c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
