Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGALR1
LigandBDBM50273367
Substrate/Competitorn/a
Ki 0.27±n/a nM
CommentsPDSP_3165
Citation Howard ADTan CShiao LLPalyha OCMcKee KKWeinberg DHFeighner SDCascieri MASmith RGVan Der Ploeg LHSullivan KA Molecular cloning and characterization of a new receptor for galanin. FEBS Lett 405:285-90 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
GALR1
Name:GALR1
Synonyms:Galanin R1 | Galanin receptor type 1
Type:Enzyme Catalytic Domain
Mol. Mass.:38883.91
Organism:RAT
Description:Galanin R1 GALR1 RAT::Q62805
Residue:346
Sequence:
MELAPVNLSEGNGSDPEPPAEPRPLFGIGVENFITLVVFGLIFAMGVLGNSLVITVLARS
KPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLV
SIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALSIAMASPVAYYQRLFHRDS
NQTFCWEHWPNQLHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEASK
KKTAQTVLVVVVVFGISWLPHHVIHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPII
YAFLSENFRKAYKQVFKCRVCNESPHGDAKEKNRIDTPPSTNCTHV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50273367
n/a
NameBDBM50273367
Synonyms:(2S,3S)-2-((S)-2-((S)-2-((S)-1-(2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S)-4-amino-2-((S)-2-((2S,3R)-2-((S)-2-(2-aminoacetamido)-3-(1H-indol-3-yl)propanamido)-3-hydroxybutanamido)-4-methylpentanamido)-4-oxobutanamido)-3-hydroxypropanamido)propanamido)acetamido)-3-(4-hydroxyphenyl)propanamido)-4-methylpentanamido)-4-methylpentanamido)acetyl)pyrrolidine-2-carboxamido)-3-(1H-imidazol-5-yl)propanamido)propanamido)-3-methylpentanoic acid | CHEMBL499980 | Galanin (1-16) | Galanin (1-16), porcine | Galanin (1-16), rat
TypeSmall organic molecule
Emp. Form.C78H116N20O21
Mol. Mass.1669.877
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: