| Reaction Details |
|---|
 | Report a problem with these data |
| Target | CB1 cannabinoid receptor-interacting protein 1 |
|---|
| Ligand | BDBM21244 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 33.8±n/a nM |
|---|
| Comments | PDSP_572 |
|---|
| Citation |  Stefano, GB; Salzet, B; Salzet, M Identification and characterization of the leech CNS cannabinoid receptor: coupling to nitric oxide release. Brain Res753:219-24 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| CB1 cannabinoid receptor-interacting protein 1 |
|---|
| Name: | CB1 cannabinoid receptor-interacting protein 1 |
|---|
| Synonyms: | CANNABINOID CB1 | CNR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 22425.67 |
|---|
| Organism: | theromyzon Tessulatum |
|---|
| Description: | CANNABINOID CB1 CNR1 theromyzon Tessulatum::A0A0V1DID4 |
|---|
| Residue: | 196 |
|---|
| Sequence: | MDTMTMETLLLSSTLLLLPFNKHGGAKLAGWLVNDLPRRRIMKPPSRFEVHIRFCCLKPE
NAETTFKVDGRRFNMSTKTLKLYRDTTYRIGVTSSPPMEFEEAEINGENLISHLEPDGGI
EADWSTAGFSKTKSRSRCNIRLMLRGVFGSVTQDLQCKFYDISDPHAQWGDKFRQMVLVC
STYDDCMINVVEVELK
|
|
|
|---|
| BDBM21244 |
|---|
| n/a |
|---|
| Name | BDBM21244 |
|---|
| Synonyms: | 2-[(1S,2S,5S)-5-hydroxy-2-(3-hydroxypropyl)cyclohexyl]-5-(2-methyloctan-2-yl)phenol | 3-(2-hydroxy-4-(1,1-dimethylheptyl)phenyl)-4-(3-hydroxypropyl)cyclohexanol | CP 55,940 | CP-55,940 | CP-56667 [(+)-AC],XV | [3H]-56 | [3H]CP55940 |
|---|
| Type | radiolabeled ligand |
|---|
| Emp. Form. | C24H40O3 |
|---|
| Mol. Mass. | 376.5726 |
|---|
| SMILES | CCCCCCC(C)(C)c1ccc([C@H]2C[C@@H](O)CC[C@@H]2CCCO)c(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
