Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCNR1
LigandBDBM21015
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_616
Citation Stefano GBSalzet BSalzet M Identification and characterization of the leech CNS cannabinoid receptor: coupling to nitric oxide release. Brain Res 753:219-24 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
CNR1
Name:CNR1
Synonyms:CANNABINOID CB1
Type:Enzyme Catalytic Domain
Mol. Mass.:22425.67
Organism:theromyzon Tessulatum
Description:CANNABINOID CB1 CNR1 theromyzon Tessulatum::A0A0V1DID4
Residue:196
Sequence:
MDTMTMETLLLSSTLLLLPFNKHGGAKLAGWLVNDLPRRRIMKPPSRFEVHIRFCCLKPE
NAETTFKVDGRRFNMSTKTLKLYRDTTYRIGVTSSPPMEFEEAEINGENLISHLEPDGGI
EADWSTAGFSKTKSRSRCNIRLMLRGVFGSVTQDLQCKFYDISDPHAQWGDKFRQMVLVC
STYDDCMINVVEVELK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21015
n/a
NameBDBM21015
Synonyms:(2S)-2-{2-[(2R)-2-[(2S)-2-amino-3-(4-hydroxyphenyl)propanamido]propanamido]-N-methylacetamido}-N-(2-hydroxyethyl)-3-phenylpropanamide | 2-Ala-4-MePhe-5-Gly-Enkephalin | CHEMBL38874 | D-Ala2-MePhe4-Met(0)5-enkephalin-ol | DAMGO | RX 783006 | [3H]DAMGO | [tyrosyl-3,5-3H(N)]-D-Ala2-Mephe4-glyol5-enkephalin
TypeAnalgesics
Emp. Form.C26H35N5O6
Mol. Mass.513.586
SMILESC[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)NCC(=O)N(C)[C@@H](Cc1ccccc1)C(=O)NCCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: