Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCNR1
LigandBDBM55121
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_728
Citation Stefano GBSalzet BSalzet M Identification and characterization of the leech CNS cannabinoid receptor: coupling to nitric oxide release. Brain Res 753:219-24 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
CNR1
Name:CNR1
Synonyms:CANNABINOID CB1
Type:Enzyme Catalytic Domain
Mol. Mass.:44900.17
Organism:Hirudo medicinalis
Description:CANNABINOID CB1 CNR1 Hirudo medicinalis::A0A0H4AWC7
Residue:396
Sequence:
PYLGSNDIQYEDIKSDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITE
FYNKSLSSYKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCV
ILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASF
TASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKL
QSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIH
TSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFA
FCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM55121
n/a
NameBDBM55121
Synonyms:3-HYDROXYTYRAMINE HYDROCHLORIDE | 4-(2-aminoethyl)benzene-1,2-diol;hydrochloride | 4-(2-aminoethyl)pyrocatechol;hydrochloride | 4-(2-azanylethyl)benzene-1,2-diol;hydrochloride | DOPAMINE | Dopamine | MLS000069419 | SMR000059081 | cid_65340
TypeSmall organic molecule
Emp. Form.C8H11NO2
Mol. Mass.153.1784
SMILESNCCc1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: