Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCNR1
LigandBDBM21008
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_740
Citation Stefano GBSalzet BSalzet M Identification and characterization of the leech CNS cannabinoid receptor: coupling to nitric oxide release. Brain Res 753:219-24 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
CNR1
Name:CNR1
Synonyms:CANNABINOID CB1
Type:Enzyme Catalytic Domain
Mol. Mass.:22425.67
Organism:theromyzon Tessulatum
Description:CANNABINOID CB1 CNR1 theromyzon Tessulatum::A0A0V1DID4
Residue:196
Sequence:
MDTMTMETLLLSSTLLLLPFNKHGGAKLAGWLVNDLPRRRIMKPPSRFEVHIRFCCLKPE
NAETTFKVDGRRFNMSTKTLKLYRDTTYRIGVTSSPPMEFEEAEINGENLISHLEPDGGI
EADWSTAGFSKTKSRSRCNIRLMLRGVFGSVTQDLQCKFYDISDPHAQWGDKFRQMVLVC
STYDDCMINVVEVELK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21008
n/a
NameBDBM21008
Synonyms:(4S,7S,13S)-13-[(2S)-2-amino-3-(4-hydroxyphenyl)propanamido]-7-benzyl-3,3,14,14-tetramethyl-6,9,12-trioxo-1,2-dithia-5,8,11-triazacyclotetradecane-4-carboxylic acid | CHEMBL31421 | DPDPE | DPDPE-Cl | DPDPE-OH | Enkephalin, [Tyrosyl-2,6-3H(N)]- (2-D-Penicillamine, 5-D-Penicillamine) | [3H]DPDPE
TypeAnalgesics
Emp. Form.C30H39N5O7S2
Mol. Mass.645.79
SMILESCC1(C)SSC(C)(C)[C@@H](NC(=O)[C@@H](N)Cc2ccc(O)cc2)C(=O)NCC(=O)N[C@@H](Cc2ccccc2)C(=O)N[C@H]1C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: