| Reaction Details |
|---|
 | Report a problem with these data |
| Target | CB1 cannabinoid receptor-interacting protein 1 |
|---|
| Ligand | BDBM21008 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1000±n/a nM |
|---|
| Comments | PDSP_740 |
|---|
| Citation |  Stefano, GB; Salzet, B; Salzet, M Identification and characterization of the leech CNS cannabinoid receptor: coupling to nitric oxide release. Brain Res753:219-24 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| CB1 cannabinoid receptor-interacting protein 1 |
|---|
| Name: | CB1 cannabinoid receptor-interacting protein 1 |
|---|
| Synonyms: | CANNABINOID CB1 | CNR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 22425.67 |
|---|
| Organism: | theromyzon Tessulatum |
|---|
| Description: | CANNABINOID CB1 CNR1 theromyzon Tessulatum::A0A0V1DID4 |
|---|
| Residue: | 196 |
|---|
| Sequence: | MDTMTMETLLLSSTLLLLPFNKHGGAKLAGWLVNDLPRRRIMKPPSRFEVHIRFCCLKPE
NAETTFKVDGRRFNMSTKTLKLYRDTTYRIGVTSSPPMEFEEAEINGENLISHLEPDGGI
EADWSTAGFSKTKSRSRCNIRLMLRGVFGSVTQDLQCKFYDISDPHAQWGDKFRQMVLVC
STYDDCMINVVEVELK
|
|
|
|---|
| BDBM21008 |
|---|
| n/a |
|---|
| Name | BDBM21008 |
|---|
| Synonyms: | (4S,7S,13S)-13-[(2S)-2-amino-3-(4-hydroxyphenyl)propanamido]-7-benzyl-3,3,14,14-tetramethyl-6,9,12-trioxo-1,2-dithia-5,8,11-triazacyclotetradecane-4-carboxylic acid | CHEMBL31421 | DPDPE | DPDPE-Cl | DPDPE-OH | Enkephalin, [Tyrosyl-2,6-3H(N)]- (2-D-Penicillamine, 5-D-Penicillamine) | [3H]DPDPE |
|---|
| Type | Analgesics |
|---|
| Emp. Form. | C30H39N5O7S2 |
|---|
| Mol. Mass. | 645.79 |
|---|
| SMILES | CC1(C)SSC(C)(C)[C@@H](NC(=O)[C@@H](N)Cc2ccc(O)cc2)C(=O)NCC(=O)N[C@@H](Cc2ccccc2)C(=O)N[C@H]1C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
