Reaction Details |
| Report a problem with these data |
Target | CB1 cannabinoid receptor-interacting protein 1 |
---|
Ligand | BDBM35234 |
---|
Substrate/Competitor | n/a |
---|
Ki | 1000±n/a nM |
---|
Comments | PDSP_1348 |
---|
Citation | Stefano, GB; Salzet, B; Salzet, M Identification and characterization of the leech CNS cannabinoid receptor: coupling to nitric oxide release. Brain Res753:219-24 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
CB1 cannabinoid receptor-interacting protein 1 |
---|
Name: | CB1 cannabinoid receptor-interacting protein 1 |
Synonyms: | CANNABINOID CB1 | CNR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 22425.67 |
Organism: | theromyzon Tessulatum |
Description: | CANNABINOID CB1 CNR1 theromyzon Tessulatum::A0A0V1DID4 |
Residue: | 196 |
Sequence: | MDTMTMETLLLSSTLLLLPFNKHGGAKLAGWLVNDLPRRRIMKPPSRFEVHIRFCCLKPE
NAETTFKVDGRRFNMSTKTLKLYRDTTYRIGVTSSPPMEFEEAEINGENLISHLEPDGGI
EADWSTAGFSKTKSRSRCNIRLMLRGVFGSVTQDLQCKFYDISDPHAQWGDKFRQMVLVC
STYDDCMINVVEVELK
|
|
|
BDBM35234 |
---|
n/a |
---|
Name | BDBM35234 |
Synonyms: | DL-[7-3H]norepinephrine | NOREPINEPHRINE | Noradrenaline,(+) | [3H]NE |
Type | radiolabeled ligand |
Emp. Form. | C8H11NO3 |
Mol. Mass. | 169.1778 |
SMILES | NCC(O)c1ccc(O)c(O)c1 |
Structure |
|