| Reaction Details |
|---|
 | Report a problem with these data |
| Target | CB1 cannabinoid receptor-interacting protein 1 |
|---|
| Ligand | BDBM21281 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 58.6±n/a nM |
|---|
| Comments | PDSP_1966 |
|---|
| Citation |  Stefano, GB; Salzet, B; Salzet, M Identification and characterization of the leech CNS cannabinoid receptor: coupling to nitric oxide release. Brain Res753:219-24 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| CB1 cannabinoid receptor-interacting protein 1 |
|---|
| Name: | CB1 cannabinoid receptor-interacting protein 1 |
|---|
| Synonyms: | CANNABINOID CB1 | CNR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 22425.67 |
|---|
| Organism: | theromyzon Tessulatum |
|---|
| Description: | CANNABINOID CB1 CNR1 theromyzon Tessulatum::A0A0V1DID4 |
|---|
| Residue: | 196 |
|---|
| Sequence: | MDTMTMETLLLSSTLLLLPFNKHGGAKLAGWLVNDLPRRRIMKPPSRFEVHIRFCCLKPE
NAETTFKVDGRRFNMSTKTLKLYRDTTYRIGVTSSPPMEFEEAEINGENLISHLEPDGGI
EADWSTAGFSKTKSRSRCNIRLMLRGVFGSVTQDLQCKFYDISDPHAQWGDKFRQMVLVC
STYDDCMINVVEVELK
|
|
|
|---|
| BDBM21281 |
|---|
| n/a |
|---|
| Name | BDBM21281 |
|---|
| Synonyms: | (11R)-2-methyl-11-(morpholin-4-ylmethyl)-3-(naphthalen-1-ylcarbonyl)-9-oxa-1-azatricyclo[6.3.1.0^{4,12}]dodeca-2,4(12),5,7-tetraene | (2,3-dihydro-5-methyl-3-((4-morpholinyl)methyl)pyrrolo-(1,2,3-de)-1,4-benzoxazin-6-yl)(1-naphthalenyl)methanone monomethanesulfonat | CHEMBL188 | WIN 55,212-2 | WIN 55212-2 | WIN-55212 | WIN55212-2 |
|---|
| Type | Analgesic |
|---|
| Emp. Form. | C27H26N2O3 |
|---|
| Mol. Mass. | 426.5069 |
|---|
| SMILES | Cc1c(C(=O)c2cccc3ccccc23)c2cccc3OC[C@@H](CN4CCOCC4)n1c23 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
