Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 4 (mGluR4)
LigandBDBM17657
Substrate/Competitorn/a
Ki 3000±n/a nM
CommentsPDSP_873
Citation Conn PJPin JP Pharmacology and functions of metabotropic glutamate receptors. Annu Rev Pharmacol Toxicol 37:205-37 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
Metabotropic glutamate receptor 4 (mGluR4)
Name:Metabotropic glutamate receptor 4
Synonyms:GRM4 | Glutamate receptor, metabotropic 4 | Metabotropic glutamate receptor 4 | mGluR4 | metabotropic glutamate 4
Type:Protein
Mol. Mass.:101899.95
Organism:Homo sapiens (Human)
Description:Q14833
Residue:912
Sequence:
MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQ
KSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNDSAEYKVIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIA
ATLFVVITFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALAT
KQTYVTYTNHAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17657
n/a
NameBDBM17657
Synonyms:(2S)-2-aminopentanedioic acid | (S)-Glu | D-Glutamate | Glutamate | L-Glu | L-Glutamate | L-Glutamic acid | L-[14C(U)]glutamate | L-gluatmate
TypeAmino Acid
Emp. Form.C5H9NO4
Mol. Mass.147.1293
SMILESN[C@@H](CCC(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: