Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM10755
Substrate/Competitorn/a
Ki 2.00±n/a nM
CommentsPDSP_150
Citation Eglen RMJasper JRChang DJMartin GR The 5-HT7 receptor: orphan found. Trends Pharmacol Sci 18:104-7 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
Serotonin (5-HT) receptor
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-7 | 5-HT-X | 5-HT7 | 5-HT7L | 5-HT7S | 5-Hydroxytryptamine receptor 7 (5-HT7) | 5-hydroxytryptamine receptor 7 | 5-hydroxytryptamine receptor 7 (5-HT-7) | Adrenergic Alpha | GPRFO | HTR7 | Serotonin Receptor 7
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:49852.62
Organism:Rattus norvegicus (rat)
Description:Rat cloned 5-HT7R.
Residue:448
Sequence:
MMDVNSSGRPDLYGHLRSLILPEVGRGLQDLSPDGGAHPVVSSWMPHLLSGFLEVTASPA
PTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSN
YLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVIS
IDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDF
GYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVQPESVISLNGVVKLQK
EVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTS
CSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE
ALKLAERPERSEFVLQNSDHCGKKGHDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10755
n/a
NameBDBM10755
Synonyms:14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT
TypeSmall organic molecule
Emp. Form.C10H12N2O
Mol. Mass.176.2151
SMILESNCCc1c[nH]c2ccc(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: